HPA021371

FAM131B antibody from Sigma-Aldrich
KIAA0773
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021371
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021371, RRID:AB_1852341
Product name
Anti-FAM131B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021371
Antibody type
Polyclonal
Antigen
Protein FAM131B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDSTSSLHGSSLHRPSTEQTRTDFSWDGINLSMED
TTSILPKLKRNSNAYGIGALAKSSFSGISRSMKDH
VTKPTAMGQGRVAHM
Storage
-20C
Provider Type Product Number
- No reagents -