Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003297-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003297-A01, RRID:AB_462857
- Product name
- HSF1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HSF1.
- Antigen sequence
PSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEA
ENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLP
VLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAK
DPTVS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Aqueous Extract of Paeonia lactiflora and Paeoniflorin as Aggregation Reducers Targeting Chaperones in Cell Models of Spinocerebellar Ataxia 3.
Proinvasion metastasis drivers in early-stage melanoma are oncogenes.
Chang KH, Chen WL, Lee LC, Lin CH, Kung PJ, Lin TH, Wu YC, Wu YR, Chen YC, Lee-Chen GJ, Chen CM
Evidence-based complementary and alternative medicine : eCAM 2013;2013:471659
Evidence-based complementary and alternative medicine : eCAM 2013;2013:471659
Proinvasion metastasis drivers in early-stage melanoma are oncogenes.
Scott KL, Nogueira C, Heffernan TP, van Doorn R, Dhakal S, Hanna JA, Min C, Jaskelioff M, Xiao Y, Wu CJ, Cameron LA, Perry SR, Zeid R, Feinberg T, Kim M, Vande Woude G, Granter SR, Bosenberg M, Chu GC, DePinho RA, Rimm DL, Chin L
Cancer cell 2011 Jul 12;20(1):92-103
Cancer cell 2011 Jul 12;20(1):92-103
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HSF1 polyclonal antibody (A01), Lot # 060726QCS1. Western Blot analysis of HSF1 expression in Jurkat.