HPA008888

HSF1 antibody from Sigma-Aldrich
HSTF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008888
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008888, RRID:AB_1079088
Product name
Anti-HSF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008888
Antibody type
Polyclonal
Antigen
Heat shock factor protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVF
DQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVV
HIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKR
KVTSVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQE
CMDSKLLA
Storage
-20C
Provider Type Product Number
- No reagents -