H00090025-B01P

UBE3D antibody from Abnova Corporation
C6orf157, DKFZp434A1520, H10BH, UBE2CBP, YJR141W
No application information provided.

Antibody data

Product number
H00090025-B01P
Provider
Abnova Corporation
Product name
UBE3D purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00090025-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human UBE3D protein.
Antigen sequence
MAASAAETRVFLEVRGQLQSALLILGEPKEGGMPM
NISIMPSSLQMKTPEGCTEIQLPAEVRLVPSSCRG
LQFVVGDGLHLRLQTQAKLGTKLISMFNQSSQTQE
CCTFYCQSCGEVIIKDRKLLRVLPLPSENWGALVG
EWCCHPDPFANKSLHPQENDCFIGDSFFLVNLRTS
LWQQRPELSPVEMCCVSSDNHCKLEPKANTKVICK
RCKVMLGETVSSETTKFYMTEIIIQSSERSFPIIP
RSWFVQSVIAQCLVQLSSARSTFRFTIQGQDDKVY
ILLWLLNSDSLVIESLRNSKYIKKFPLLENTFKAD
SSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHP
LTLPSATCLELLLILSKSNANLPSSLRRVNSFQVA
FLKM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -