HPA026897

WDR33 antibody from Atlas Antibodies
FLJ11294, NET14, WDC146

Antibody data

Product number
HPA026897
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026897, RRID:AB_1858803
Product name
Anti-WDR33
Provider product page
Atlas Antibodies - HPA026897
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYL
ENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNP
MNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTG
ASSGEFTLWNGLTFNF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.