HPA026897

WDR33 antibody from Sigma-Aldrich
FLJ11294, NET14, WDC146
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026897
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026897, RRID:AB_1858803
Product name
Anti-WDR33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026897
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 33 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYL
ENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNP
MNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTG
ASSGEFTLWNGLTFNF
Storage
-20C
Provider Type Product Number
- No reagents -