HPA020051

IFT81 antibody from Atlas Antibodies
CDV-1R, CDV1, MGC4027
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020051
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020051, RRID:AB_1851465
Product name
Anti-IFT81
Provider product page
Atlas Antibodies - HPA020051
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLS
DVLAEIDPKQLVDIREEMPEQTAKRMLSLLGILKY
KPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRT
NELKKR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -