HPA019087

IFT81 antibody from Sigma-Aldrich
CDV-1R, CDV1, MGC4027
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019087
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019087, RRID:AB_1851462
Product name
Anti-IFT81 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019087
Antibody type
Polyclonal
Antigen
Intraflagellar transport protein 81 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVVSEPAMGHSDLLELESKINEINTEINQLIEKKM
MRNEPIEGKLSLYRQQASIISRKKEAKAEELQEAK
EKLASLEREASVKRNQTREFDGTEV
Storage
-20C
Provider Type Product Number
- No reagents -