HPA003502

TMEM260 antibody from Sigma-Aldrich
C14orf101, FLJ20392
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003502
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003502, RRID:AB_1078314
Product name
Anti-C14orf101 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003502
Antibody type
Polyclonal
Antigen
UPF0679 protein C14orf101 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSYLNHARWTWGDQTTLQGFLTHFLREEYGTFSLA
KSEIGSSMSEILLSQVTNMRTELSFNIQALAVCAN
ICLATKDRQNP
Storage
-20C
Provider Type Product Number
- No reagents -