Antibody data

Product number
ABIN183164
Provider
antibodies-online
Product name
anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7) (C-Term) antibody
Provider product page
antibodies-online - ABIN183164
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNA7 antibody: synthetic peptide directed towards the C terminal of human KCNA7
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELP
PPLWA PPGKHLVTEV
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -