AV35365

KCNA7 antibody from Sigma-Aldrich
HAK6, Kv1.7
No application information provided.

Antibody data

Product number
AV35365
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV35365, RRID:AB_1855576
Product name
Anti-KCNA7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV35365
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human KCNA7 with an internal ID of P06603
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFSYFYHRETEGEEAGMFSHVDMQPCGPLEGKANG
GLVDGEVPELPPPLW
Storage
-20C
Provider Type Product Number
- No reagents -