HPA018259

SMC4 antibody from Sigma-Aldrich
CAP-C, hCAP-C, SMC4L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018259
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018259, RRID:AB_1857282
Product name
Anti-SMC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018259
Antibody type
Polyclonal
Antigen
Structural maintenance of chromosomes protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTLVADNLDQATRVAYQKDRRWRVVTLQGQIIEQS
GTMTGGGSKVMKGRMGSSLVIEISEEEVNKMESQL
QNDSKKAMQIQEQKVQLEERVVKLRHSEREMRNTL
EKFTASIQRLIEQEEYLNVQVKELEANVLATAPD
Storage
-20C
Provider Type Product Number
- No reagents -