HPA020980

ARHGEF5 antibody from Sigma-Aldrich
GEF5, P60, TIM, TIM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020980
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020980, RRID:AB_1845007
Product name
Anti-ARHGEF5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020980
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PAREPLRRTTPQQGASGPGRSPVGQARQPEKPSHL
HLEKASSWPHRRDSGRPPGDSSGQAVAPSEGANKH
KGWS
Storage
-20C
Provider Type Product Number
- No reagents -