HPA017750

TRIM59 antibody from Sigma-Aldrich
Mrf1, RNF104, TRIM57, TSBF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017750
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017750, RRID:AB_1858312
Product name
Anti-TRIM59 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017750
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 59 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLE
NILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGI
ESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPL
NVYCLL
Storage
-20C
Provider Type Product Number
- No reagents -