H00009967-B01P

THRAP3 antibody from Abnova Corporation
BCLAF2, TRAP150
No application information provided.

Antibody data

Product number
H00009967-B01P
Provider
Abnova Corporation
Product name
THRAP3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00009967-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human THRAP3 protein.
Antigen sequence
MSKTNKSKSGSRSSRSRSASRSRSRSFSKSRSRSR
SLSRSRKRRLSSRSRSRSYSPAHNRERNHPRVYQN
RDFRGHNRGYRRPYYFRGRNRGFYPWGQYNRGGYG
NYRSNWQNYRQAYSPRRGRSRSRSPKRRSPSPRSR
SHSRNSDKSSSDRSRRSSSSRSSSNHSRVESSKRK
SAKEKKSSSKDSRPSQAAGDNQGDEAKEQTFSGGT
SQDTKASESSKPWPDATYGTGSASRASAVSELSPR
ERSPALKSPLQSVVVRRRSPRPSPVPKPSPPLSST
SQMGSTLPSGAGYQSGTHQGQFDHGSGSLSPSKKS
PVGKSPPSTGSTYGSSQKEESAASGGAAYTKRYLE
EQKTENGKDKEQKQTNTDKEKIKEKGSFSDTGLGD
GKMKSDSFAPKTDSEKPFRGSQSPKRYKLRDDFEK
KMADFHKEEMDDQDKDKAKGRKESEFDDEPKFMSK
VIGANKNQEEEKSGKWEGLVYAPPGKEKQRKTEEL
EEESFPERSKKEDRGKRSEGGHRGFVPEKNFRVTA
YKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSS
FSITREAQVNVRMDSFDEDLARPSGLLAQERKLCR
DLVHSNKKEQEFRSIFQHIQSAQSQRSPSELFAQH
IVTIVHHVKEHHFGSSGMTLHERFTKYLKRGTEQE
AAKNKKSPEIHRRIDISPSTFRKHGLAHDEMKSPR
EPGYKAEGKYKDDPVDLRLDIERRKKHKERDLKRG
KSRESVDSRDSSHSRERSAEKTEKTHKGSKKQKKH
RRARDRSRSSSSSSQSSHSYKAEEYTEETEEREES
TTGFDKSRLGTKDFVGPSERGGGRARGTFQFRARG
RGWGRGNYSGNNNNNSNNDFQKRNREEEWDPEYTP
KSKKYYLHDDREGEGSDKWVSRGRGRGAFPRGRGR
FMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENRE
EKDNIQPTTE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -