HPA012041

THRAP3 antibody from Sigma-Aldrich
TRAP150
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012041
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012041, RRID:AB_1857983
Product name
Anti-THRAP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012041
Antibody type
Polyclonal
Antigen
Thyroid hormone receptor-associated protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETEEREESTTGFDKSRLGTKDFVGPSERGGGRARG
TFQFRARGRGWGRGNYSGNNNNNSNNDFQKRNREE
EWDPEYTPKSKKYYLHDDREGEGSDKWVSRGRGRG
AFPRGRGRFMFRKSSTSPKWAHDKFS
Storage
-20C
Provider Type Product Number
- No reagents -