Antibody data

Product number
HPA012041
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012041, RRID:AB_1857983
Product name
Anti-THRAP3
Provider product page
Atlas Antibodies - HPA012041
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ETEEREESTTGFDKSRLGTKDFVGPSERGGGRARG
TFQFRARGRGWGRGNYSGNNNNNSNNDFQKRNREE
EWDPEYTPKSKKYYLHDDREGEGSDKWVSRGRGRG
AFPRGRGRFMFRKSSTSPKWAHDKFS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.