ABIN406415

KPNA4 antibody from antibodies-online
IPOA3, MGC12217, MGC26703, QIP1, SRP3

Antibody data

Product number
ABIN406415
Provider
antibodies-online
Product name
anti-Karyopherin alpha 3 (Importin alpha 4) (KPNA3) (N-Term) antibody
Provider product page
antibodies-online - ABIN406415
Antibody type
Polyclonal
Antigen
The immunogen for anti-KPNA3 antibody: synthetic peptide directed towards the N terminal of human KPNA3
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVEL
RKNKR DEHLLKKRNV
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -