HPA021849

TPK1 antibody from Atlas Antibodies
HTPK1, PP20
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021849
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021849, RRID:AB_1858210
Product name
Anti-TPK1
Provider product page
Atlas Antibodies - HPA021849
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNK
ALLRACADGGANRLYDITEGERESFLPEFINGDFD
SI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -