HPA021545

TPK1 antibody from Sigma-Aldrich
HTPK1, PP20
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021545
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021545, RRID:AB_1858209
Product name
Anti-TPK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021545
Antibody type
Polyclonal
Antigen
Thiamin pyrophosphokinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNL
TNDVLAFGTLVSTSNTYDGSGVVTVETDHPL
Storage
-20C
Provider Type Product Number
- No reagents -