HPA019891

PPM1L antibody from MilliporeSigma / Merck KGaA
PP2CE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019891
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019891, RRID:AB_1855631
Product name
Anti-PPM1L antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019891
Antibody type
Polyclonal
Antigen
Protein phosphatase 1L recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFIS
FNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDIL
TF
Storage
-20C
Provider Type Product Number
- No reagents -