HPA019953

PPM1L antibody from Sigma-Aldrich
PP2CE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019953
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019953, RRID:AB_2170360
Product name
Anti-PPM1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019953
Antibody type
Polyclonal
Antigen
Protein phosphatase 1L recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLD
EPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK
Storage
-20C
Provider Type Product Number
- No reagents -