HPA008890

PTTG1 antibody from Atlas Antibodies
EAP1, HPTTG, PTTG, securin, TUTR1

Antibody data

Product number
HPA008890
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008890, RRID:AB_1079717
Product name
Anti-PTTG1
Provider product page
Atlas Antibodies - HPA008890
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PPALPKATRKALGTVNRATEKSVKTKGPLKQKQPS
FSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPFNP
LDFESFDLPEEHQIAHLPLSGVPLMILDEERELEK
LFQLGPPSPVKMPSPPWESNLLQSPSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.