WH0051167M1

CYB5R4 antibody from Sigma-Aldrich
b5+b5R, dJ676J13.1, NCB5OR
ELISA
Recommended by provider

Antibody data

Product number
WH0051167M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0051167M1, RRID:AB_1841095
Product name
Monoclonal Anti-CYB5R4 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0051167M1
Antibody type
Monoclonal
Antigen
CYB5R4 (NP_057314, a.a. 388-488) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
VKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVL
SAPISEWNGKQGHISPALLSEFLKRNLDKSKVLVC
ICGPVPFTEQGVRLLHDLNFSKNEIHSFTA* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -