Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- WH0051167M1 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Monoclonal Anti-CYB5R4 antibody produced in mouse
- Antibody type
- Monoclonal
- Antigen
- CYB5R4 (NP_057314, a.a. 388-488) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
- Description
- purified immunoglobulin
- Reactivity
- Human
- Antigen sequence
VKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVL
SAPISEWNGKQGHISPALLSEFLKRNLDKSKVLVC
ICGPVPFTEQGVRLLHDLNFSKNEIHSFTA* (wi
thout GST)- Isotype
- IgG
- Storage
- -20C
No comments: Submit comment
No validations: Submit validation data