HPA018992

CYB5R4 antibody from Sigma-Aldrich
b5+b5R, dJ676J13.1, NCB5OR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018992
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018992, RRID:AB_1847371
Product name
Anti-CYB5R4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018992
Antibody type
Polyclonal
Antigen
Cytochrome b5 reductase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEF
VLSAPISEWNGKQGHISPALLSEFLKRNLDKSKVL
VCICGPVPFTEQGVRLLHDLNFSK
Storage
-20C
Provider Type Product Number
- No reagents -