HPA018992

CYB5R4 antibody from Atlas Antibodies
b5+b5R, dJ676J13.1, NCB5OR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018992
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018992, RRID:AB_1847371
Product name
Anti-CYB5R4
Provider product page
Atlas Antibodies - HPA018992
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RKVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEF
VLSAPISEWNGKQGHISPALLSEFLKRNLDKSKVL
VCICGPVPFTEQGVRLLHDLNFSK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -