Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023435-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023435-A01, RRID:AB_461752
- Product name
- TARDBP polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant TARDBP.
- Antigen sequence
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQF
PGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN
LVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSD
LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLK
TGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDC
KLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREF
FSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCG
EDLIIKGISVHISNA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cell stress induces TDP-43 pathological changes associated with ERK1/2 dysfunction: implications in ALS.
TDP-43 pathology in familial British dementia.
Mimicking aspects of frontotemporal lobar degeneration and Lou Gehrig's disease in rats via TDP-43 overexpression.
Colocalization of transactivation-responsive DNA-binding protein 43 and huntingtin in inclusions of Huntington disease.
A yeast TDP-43 proteinopathy model: Exploring the molecular determinants of TDP-43 aggregation and cellular toxicity.
Ayala V, Granado-Serrano AB, Cacabelos D, Naudà A, Ilieva EV, Boada J, Caraballo-Miralles V, Lladó J, Ferrer I, Pamplona R, Portero-Otin M
Acta neuropathologica 2011 Sep;122(3):259-70
Acta neuropathologica 2011 Sep;122(3):259-70
TDP-43 pathology in familial British dementia.
Schwab C, Arai T, Hasegawa M, Akiyama H, Yu S, McGeer PL
Acta neuropathologica 2009 Aug;118(2):303-11
Acta neuropathologica 2009 Aug;118(2):303-11
Mimicking aspects of frontotemporal lobar degeneration and Lou Gehrig's disease in rats via TDP-43 overexpression.
Tatom JB, Wang DB, Dayton RD, Skalli O, Hutton ML, Dickson DW, Klein RL
Molecular therapy : the journal of the American Society of Gene Therapy 2009 Apr;17(4):607-13
Molecular therapy : the journal of the American Society of Gene Therapy 2009 Apr;17(4):607-13
Colocalization of transactivation-responsive DNA-binding protein 43 and huntingtin in inclusions of Huntington disease.
Schwab C, Arai T, Hasegawa M, Yu S, McGeer PL
Journal of neuropathology and experimental neurology 2008 Dec;67(12):1159-65
Journal of neuropathology and experimental neurology 2008 Dec;67(12):1159-65
A yeast TDP-43 proteinopathy model: Exploring the molecular determinants of TDP-43 aggregation and cellular toxicity.
Johnson BS, McCaffery JM, Lindquist S, Gitler AD
Proceedings of the National Academy of Sciences of the United States of America 2008 Apr 29;105(17):6439-44
Proceedings of the National Academy of Sciences of the United States of America 2008 Apr 29;105(17):6439-44
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TARDBP polyclonal antibody (A01), Lot # Abnova060510QCS1 Western Blot analysis of TARDBP expression in IMR-32 ( Cat # L008V1 ).