Antibody data
- Antibody Data
- Antigen structure
- References [119]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023435-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023435-M01, RRID:AB_425904
- Product name
- TARDBP monoclonal antibody (M01), clone 2E2-D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TARDBP.
- Antigen sequence
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQF
PGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN
LVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSD
LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLK
TGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDC
KLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREF
FSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCG
EDLIIKGISVHISNA- Isotype
- IgG
- Antibody clone number
- 2E2-D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Early diagnosis of cardiac involvement in idiopathic inflammatory myopathy by cardiac magnetic resonance tomography.
Cytoplasmic mislocalization of RNA splicing factors and aberrant neuronal gene splicing in TDP-43 transgenic pig brain.
Neuropathological assessments of the pathology in frontotemporal lobar degeneration with TDP43-positive inclusions: an inter-laboratory study by the BrainNet Europe consortium.
Casein kinase II induced polymerization of soluble TDP-43 into filaments is inhibited by heat shock proteins.
A 6.4 Mb duplication of the α-synuclein locus causing frontotemporal dementia and Parkinsonism: phenotype-genotype correlations.
TDP-43 causes differential pathology in neuronal versus glial cells in the mouse brain.
Plasma phosphorylated TDP-43 levels are elevated in patients with frontotemporal dementia carrying a C9orf72 repeat expansion or a GRN mutation.
A pathogenic progranulin mutation and C9orf72 repeat expansion in a family with frontotemporal dementia.
Widespread RNA metabolism impairment in sporadic inclusion body myositis TDP43-proteinopathy.
Multiple organ involvement by alpha-synuclein pathology in Lewy body disorders.
UBE2E ubiquitin-conjugating enzymes and ubiquitin isopeptidase Y regulate TDP-43 protein ubiquitination.
Cell injury and premature neurodegeneration in focal malformations of cortical development.
The novel MAPT mutation K298E: mechanisms of mutant tau toxicity, brain pathology and tau expression in induced fibroblast-derived neurons.
Disease-associated mutations of TDP-43 promote turnover of the protein through the proteasomal pathway.
No interaction between tau and TDP-43 pathologies in either frontotemporal lobar degeneration or motor neurone disease.
TDP-1, the Caenorhabditis elegans ortholog of TDP-43, limits the accumulation of double-stranded RNA.
Clinical and neuropathological variability in clinically isolated central nervous system Whipple's disease.
Reduced cellular Ca(2+) availability enhances TDP-43 cleavage by apoptotic caspases.
Parkin reverses TDP-43-induced cell death and failure of amino acid homeostasis.
Interaction of transactive response DNA binding protein 43 with nuclear factor κB in mild cognitive impairment with episodic memory deficits.
ALS-associated TDP-43 induces endoplasmic reticulum stress, which drives cytoplasmic TDP-43 accumulation and stress granule formation.
Reduced cholinergic olfactory centrifugal inputs in patients with neurodegenerative disorders and MPTP-treated monkeys.
Neurodegenerative disease status and post-mortem pathology in idiopathic rapid-eye-movement sleep behaviour disorder: an observational cohort study.
MAPT H1 haplotype is associated with enhanced α-synuclein deposition in dementia with Lewy bodies.
Characterization of thorn-shaped astrocytes in white matter of temporal lobe in Alzheimer's disease brains.
Reactive astrocytes secrete lcn2 to promote neuron death.
Primary progressive aphasia with parkinsonism.
Asymptomatic hyper-creatine-kinase-emia as sole manifestation of inclusion body myositis.
Selective forelimb impairment in rats expressing a pathological TDP-43 25 kDa C-terminal fragment to mimic amyotrophic lateral sclerosis.
Globular glial-like inclusions in a patient with advanced Alzheimer's disease.
The long non-coding RNA nuclear-enriched abundant transcript 1_2 induces paraspeckle formation in the motor neuron during the early phase of amyotrophic lateral sclerosis.
Expression of ALS-linked TDP-43 mutant in astrocytes causes non-cell-autonomous motor neuron death in rats.
Parkin ubiquitinates Tar-DNA binding protein-43 (TDP-43) and promotes its cytosolic accumulation via interaction with histone deacetylase 6 (HDAC6).
Accelerated disease onset with stabilized familial amyotrophic lateral sclerosis (ALS)-linked mutant TDP-43 proteins.
Prominent psychiatric symptoms in patients with Parkinson's disease and concomitant argyrophilic grain disease.
Atypical neuropathological sCJD-MM phenotype with abundant white matter Kuru-type plaques sparing the cerebellar cortex.
Co-occurrence of different pathologies in dementia: implications for dementia diagnosis.
Breakpoint sequence analysis of an AβPP locus duplication associated with autosomal dominant Alzheimer's disease and severe cerebral amyloid angiopathy.
TDP-43 plasma levels are higher in amyotrophic lateral sclerosis.
An MND/ALS phenotype associated with C9orf72 repeat expansion: abundant p62-positive, TDP-43-negative inclusions in cerebral cortex, hippocampus and cerebellum but without associated cognitive decline.
XBP1 depletion precedes ubiquitin aggregation and Golgi fragmentation in TDP-43 transgenic rats.
Wild type TDP-43 induces neuro-inflammation and alters APP metabolism in lentiviral gene transfer models.
TDP-43 regulates global translational yield by splicing of exon junction complex component SKAR.
Identification of c-myc-dependent proteins in the medulloblastoma cell line D425Med.
Mutant TDP-43 in motor neurons promotes the onset and progression of ALS in rats.
Epitope mapping of antibodies against TDP-43 and detection of protease-resistant fragments of pathological TDP-43 in amyotrophic lateral sclerosis and frontotemporal lobar degeneration.
Unusual clinical presentation and neuropathology in two subjects with fused-in sarcoma (FUS) positive inclusions.
Frontotemporal lobar degeneration-related proteins induce only subtle memory-related deficits when bilaterally overexpressed in the dorsal hippocampus.
Pick's pathology in Parkinson's disease with dementia.
Abnormal regenerative responses and impaired axonal outgrowth after nerve crush in TDP-43 transgenic mouse models of amyotrophic lateral sclerosis.
Hirano body-rich subtypes of Creutzfeldt-Jakob disease.
Pathological hallmarks of amyotrophic lateral sclerosis/frontotemporal lobar degeneration in transgenic mice produced with TDP-43 genomic fragments.
Neurofibrillary tangle pathology and Braak staging in chronic epilepsy in relation to traumatic brain injury and hippocampal sclerosis: a post-mortem study.
The ALS-associated proteins FUS and TDP-43 function together to affect Drosophila locomotion and life span.
Cytoplasmic accumulation of TDP-43 in circulating lymphomonocytes of ALS patients with and without TARDBP mutations.
TAR-DNA binding protein-43 and alterations in the hippocampus.
FTLD-TDP with motor neuron disease, visuospatial impairment and a progressive supranuclear palsy-like syndrome: broadening the clinical phenotype of TDP-43 proteinopathies. A report of three cases.
TDP-43 potentiates alpha-synuclein toxicity to dopaminergic neurons in transgenic mice.
Aggregation of the 35-kDa fragment of TDP-43 causes formation of cytoplasmic inclusions and alteration of RNA processing.
Increased dopaminergic cells and protein aggregates in the olfactory bulb of patients with neurodegenerative disorders.
Distribution and pattern of pathology in subjects with familial or sporadic late-onset cerebellar ataxia as assessed by p62/sequestosome immunohistochemistry.
Molecular mechanisms of MLC1 and GLIALCAM mutations in megalencephalic leukoencephalopathy with subcortical cysts.
TDP-43 pathology may occur in the BRI2 gene-related dementias.
β-amyloid triggers ALS-associated TDP-43 pathology in AD models.
The first case of protease-sensitive prionopathy (PSPr) in The Netherlands: a patient with an unusual GSS-like clinical phenotype.
Tubulin polymerization promoting protein (TPPP/p25) as a marker for oligodendroglial changes in multiple sclerosis.
Depletion of oxidative and endoplasmic reticulum stress regulators in Pick disease.
Mutations of optineurin in amyotrophic lateral sclerosis.
Amyotrophic lateral sclerosis: dash-like accumulation of phosphorylated TDP-43 in somatodendritic and axonal compartments of somatomotor neurons of the lower brainstem and spinal cord.
ALS-associated mutations in TDP-43 increase its stability and promote TDP-43 complexes with FUS/TLS.
Knockdown of transactive response DNA-binding protein (TDP-43) downregulates histone deacetylase 6.
Characterization of alternative isoforms and inclusion body of the TAR DNA-binding protein-43.
TDP-43 transgenic mice develop spastic paralysis and neuronal inclusions characteristic of ALS and frontotemporal lobar degeneration.
TDP-43 physically interacts with amyotrophic lateral sclerosis-linked mutant CuZn superoxide dismutase.
Expansive gene transfer in the rat CNS rapidly produces amyotrophic lateral sclerosis relevant sequelae when TDP-43 is overexpressed.
Neurotoxic effects of TDP-43 overexpression in C. elegans.
Wild-type human TDP-43 expression causes TDP-43 phosphorylation, mitochondrial aggregation, motor deficits, and early mortality in transgenic mice.
Alteration of biochemical and pathological properties of TDP-43 protein by a lipid mediator, 15-deoxy-Delta(12,14)-prostaglandin J(2).
Plasma phosphorylated-TDP-43 protein levels correlate with brain pathology in frontotemporal lobar degeneration.
Cytosolic TDP-43 expression following axotomy is associated with caspase 3 activation in NFL-/- mice: support for a role for TDP-43 in the physiological response to neuronal injury.
The complement factor C5a receptor is upregulated in NFL-/- mouse motor neurons.
VCP mutations causing frontotemporal lobar degeneration disrupt localization of TDP-43 and induce cell death.
TAR DNA-Binding protein 43 accumulation in protein aggregate myopathies.
Expression of TDP-43 C-terminal Fragments in Vitro Recapitulates Pathological Features of TDP-43 Proteinopathies.
Early-onset familial lewy body dementia with extensive tauopathy: a clinical, genetic, and neuropathological study.
Increased TDP-43 protein in cerebrospinal fluid of patients with amyotrophic lateral sclerosis.
Sporadic amyotrophic lateral sclerosis of long duration is associated with relatively mild TDP-43 pathology.
Expression of collagen XVII and ubiquitin-binding protein p62 in motor neuron disease.
Divergent patterns of cytosolic TDP-43 and neuronal progranulin expression following axotomy: implications for TDP-43 in the physiological response to neuronal injury.
Frontotemporal dementia in a large Swedish family is caused by a progranulin null mutation.
Abnormal hippocampal distribution of TDP-43 in patients with-late onset psychosis.
Ubiquitin associated protein 1 is a risk factor for frontotemporal lobar degeneration.
Frontotemporal dementia presenting as schizophrenia-like psychosis in young people: clinicopathological series and review of cases.
TDP-43 accumulation in inclusion body myopathy muscle suggests a common pathogenic mechanism with frontotemporal dementia.
White matter tauopathy with globular glial inclusions: a distinct sporadic frontotemporal lobar degeneration.
TDP-43 in cerebrospinal fluid of patients with frontotemporal lobar degeneration and amyotrophic lateral sclerosis.
Disturbance of nuclear and cytoplasmic TAR DNA-binding protein (TDP-43) induces disease-like redistribution, sequestration, and aggregate formation.
A distinct clinical, neuropsychological and radiological phenotype is associated with progranulin gene mutations in a large UK series.
Epitope mapping of 2E2-D3, a monoclonal antibody directed against human TDP-43.
Molecular pathogenesis of frontotemporal lobar degeneration: basic science seminar in neurology.
Enrichment of C-terminal fragments in TAR DNA-binding protein-43 cytoplasmic inclusions in brain but not in spinal cord of frontotemporal lobar degeneration and amyotrophic lateral sclerosis.
MAPT S305I mutation: implications for argyrophilic grain disease.
TDP-43-immunoreactive neuronal and glial inclusions in the neostriatum in amyotrophic lateral sclerosis with and without dementia.
Missense mutations in the progranulin gene linked to frontotemporal lobar degeneration with ubiquitin-immunoreactive inclusions reduce progranulin production and secretion.
Colocalization of transactivation-responsive DNA-binding protein 43 and huntingtin in inclusions of Huntington disease.
Enduring involvement of tau, beta-amyloid, alpha-synuclein, ubiquitin and TDP-43 pathology in the amyotrophic lateral sclerosis/parkinsonism-dementia complex of Guam (ALS/PDC).
Ultrastructural localization of TDP-43 in filamentous neuronal inclusions in various neurodegenerative diseases.
Maturation process of TDP-43-positive neuronal cytoplasmic inclusions in amyotrophic lateral sclerosis with and without dementia.
TDP-43 protein in plasma may index TDP-43 brain pathology in Alzheimer's disease and frontotemporal lobar degeneration.
A yeast TDP-43 proteinopathy model: Exploring the molecular determinants of TDP-43 aggregation and cellular toxicity.
DEAD-box RNA helicase subunits of the Drosha complex are required for processing of rRNA and a subset of microRNAs.
TDP-43 immunoreactivity in hippocampal sclerosis and Alzheimer's disease.
Pathological TDP-43 distinguishes sporadic amyotrophic lateral sclerosis from amyotrophic lateral sclerosis with SOD1 mutations.
TDP-43 is deposited in the Guam parkinsonism-dementia complex brains.
TDP-43 immunoreactivity in neuronal inclusions in familial amyotrophic lateral sclerosis with or without SOD1 gene mutation.
TDP-43-positive white matter pathology in frontotemporal lobar degeneration with ubiquitin-positive inclusions.
TDP-43 in the ubiquitin pathology of frontotemporal dementia with VCP gene mutations.
Evidence that TDP-43 is not the major ubiquitinated target within the pathological inclusions of amyotrophic lateral sclerosis.
TDP-43 is a component of ubiquitin-positive tau-negative inclusions in frontotemporal lobar degeneration and amyotrophic lateral sclerosis.
Rosenbohm A, Buckert D, Gerischer N, Walcher T, Kassubek J, Rottbauer W, Ludolph AC, Bernhardt P
Journal of neurology 2015;262(4):949-56
Journal of neurology 2015;262(4):949-56
Cytoplasmic mislocalization of RNA splicing factors and aberrant neuronal gene splicing in TDP-43 transgenic pig brain.
Wang G, Yang H, Yan S, Wang CE, Liu X, Zhao B, Ouyang Z, Yin P, Liu Z, Zhao Y, Liu T, Fan N, Guo L, Li S, Li XJ, Lai L
Molecular neurodegeneration 2015 Sep 3;10:42
Molecular neurodegeneration 2015 Sep 3;10:42
Neuropathological assessments of the pathology in frontotemporal lobar degeneration with TDP43-positive inclusions: an inter-laboratory study by the BrainNet Europe consortium.
Alafuzoff I, Pikkarainen M, Neumann M, Arzberger T, Al-Sarraj S, Bodi I, Bogdanovic N, Bugiani O, Ferrer I, Gelpi E, Gentleman S, Giaccone G, Graeber MB, Hortobagyi T, Ince PG, Ironside JW, Kavantzas N, King A, Korkolopoulou P, Kovács GG, Meyronet D, Monoranu C, Nilsson T, Parchi P, Patsouris E, Revesz T, Roggendorf W, Rozemuller A, Seilhean D, Streichenberger N, Thal DR, Wharton SB, Kretzschmar H
Journal of neural transmission (Vienna, Austria : 1996) 2015 Jul;122(7):957-72
Journal of neural transmission (Vienna, Austria : 1996) 2015 Jul;122(7):957-72
Casein kinase II induced polymerization of soluble TDP-43 into filaments is inhibited by heat shock proteins.
Carlomagno Y, Zhang Y, Davis M, Lin WL, Cook C, Dunmore J, Tay W, Menkosky K, Cao X, Petrucelli L, Deture M
PloS one 2014;9(3):e90452
PloS one 2014;9(3):e90452
A 6.4 Mb duplication of the α-synuclein locus causing frontotemporal dementia and Parkinsonism: phenotype-genotype correlations.
Kara E, Kiely AP, Proukakis C, Giffin N, Love S, Hehir J, Rantell K, Pandraud A, Hernandez DG, Nacheva E, Pittman AM, Nalls MA, Singleton AB, Revesz T, Bhatia KP, Quinn N, Hardy J, Holton JL, Houlden H
JAMA neurology 2014 Sep;71(9):1162-71
JAMA neurology 2014 Sep;71(9):1162-71
TDP-43 causes differential pathology in neuronal versus glial cells in the mouse brain.
Yan S, Wang CE, Wei W, Gaertig MA, Lai L, Li S, Li XJ
Human molecular genetics 2014 May 15;23(10):2678-93
Human molecular genetics 2014 May 15;23(10):2678-93
Plasma phosphorylated TDP-43 levels are elevated in patients with frontotemporal dementia carrying a C9orf72 repeat expansion or a GRN mutation.
Suárez-Calvet M, Dols-Icardo O, Lladó A, Sánchez-Valle R, Hernández I, Amer G, Antón-Aguirre S, Alcolea D, Fortea J, Ferrer I, van der Zee J, Dillen L, Van Broeckhoven C, Molinuevo JL, Blesa R, Clarimón J, Lleó A
Journal of neurology, neurosurgery, and psychiatry 2014 Jun;85(6):684-91
Journal of neurology, neurosurgery, and psychiatry 2014 Jun;85(6):684-91
A pathogenic progranulin mutation and C9orf72 repeat expansion in a family with frontotemporal dementia.
Lashley T, Rohrer JD, Mahoney C, Gordon E, Beck J, Mead S, Warren J, Rossor M, Revesz T
Neuropathology and applied neurobiology 2014 Jun;40(4):502-13
Neuropathology and applied neurobiology 2014 Jun;40(4):502-13
Widespread RNA metabolism impairment in sporadic inclusion body myositis TDP43-proteinopathy.
Cortese A, Plagnol V, Brady S, Simone R, Lashley T, Acevedo-Arozena A, de Silva R, Greensmith L, Holton J, Hanna MG, Fisher EM, Fratta P
Neurobiology of aging 2014 Jun;35(6):1491-8
Neurobiology of aging 2014 Jun;35(6):1491-8
Multiple organ involvement by alpha-synuclein pathology in Lewy body disorders.
Gelpi E, Navarro-Otano J, Tolosa E, Gaig C, Compta Y, Rey MJ, Martí MJ, Hernández I, Valldeoriola F, Reñé R, Ribalta T
Movement disorders : official journal of the Movement Disorder Society 2014 Jul;29(8):1010-8
Movement disorders : official journal of the Movement Disorder Society 2014 Jul;29(8):1010-8
UBE2E ubiquitin-conjugating enzymes and ubiquitin isopeptidase Y regulate TDP-43 protein ubiquitination.
Hans F, Fiesel FC, Strong JC, Jäckel S, Rasse TM, Geisler S, Springer W, Schulz JB, Voigt A, Kahle PJ
The Journal of biological chemistry 2014 Jul 4;289(27):19164-79
The Journal of biological chemistry 2014 Jul 4;289(27):19164-79
Cell injury and premature neurodegeneration in focal malformations of cortical development.
Iyer A, Prabowo A, Anink J, Spliet WG, van Rijen PC, Aronica E
Brain pathology (Zurich, Switzerland) 2014 Jan;24(1):1-17
Brain pathology (Zurich, Switzerland) 2014 Jan;24(1):1-17
The novel MAPT mutation K298E: mechanisms of mutant tau toxicity, brain pathology and tau expression in induced fibroblast-derived neurons.
Iovino M, Pfisterer U, Holton JL, Lashley T, Swingler RJ, Calo L, Treacy R, Revesz T, Parmar M, Goedert M, Muqit MM, Spillantini MG
Acta neuropathologica 2014 Feb;127(2):283-95
Acta neuropathologica 2014 Feb;127(2):283-95
Disease-associated mutations of TDP-43 promote turnover of the protein through the proteasomal pathway.
Araki W, Minegishi S, Motoki K, Kume H, Hohjoh H, Araki YM, Tamaoka A
Molecular neurobiology 2014 Dec;50(3):1049-58
Molecular neurobiology 2014 Dec;50(3):1049-58
No interaction between tau and TDP-43 pathologies in either frontotemporal lobar degeneration or motor neurone disease.
Robinson AC, Thompson JC, Weedon L, Rollinson S, Pickering-Brown S, Snowden JS, Davidson YS, Mann DM
Neuropathology and applied neurobiology 2014 Dec;40(7):844-54
Neuropathology and applied neurobiology 2014 Dec;40(7):844-54
TDP-1, the Caenorhabditis elegans ortholog of TDP-43, limits the accumulation of double-stranded RNA.
Saldi TK, Ash PE, Wilson G, Gonzales P, Garrido-Lecca A, Roberts CM, Dostal V, Gendron TF, Stein LD, Blumenthal T, Petrucelli L, Link CD
The EMBO journal 2014 Dec 17;33(24):2947-66
The EMBO journal 2014 Dec 17;33(24):2947-66
Clinical and neuropathological variability in clinically isolated central nervous system Whipple's disease.
Balasa M, Gelpi E, Rey MJ, Vila J, Ramió-Torrentà L, Quiles Granado AM, Molina Latorre R, Lepidi H, Raoult D, Saiz A
Brain pathology (Zurich, Switzerland) 2014 Apr;24(3):230-8
Brain pathology (Zurich, Switzerland) 2014 Apr;24(3):230-8
Reduced cellular Ca(2+) availability enhances TDP-43 cleavage by apoptotic caspases.
De Marco G, Lomartire A, Mandili G, Lupino E, Buccinnà B, Ramondetti C, Moglia C, Novelli F, Piccinini M, Mostert M, Rinaudo MT, Chiò A, Calvo A
Biochimica et biophysica acta 2014 Apr;1843(4):725-34
Biochimica et biophysica acta 2014 Apr;1843(4):725-34
Parkin reverses TDP-43-induced cell death and failure of amino acid homeostasis.
Hebron M, Chen W, Miessau MJ, Lonskaya I, Moussa CE
Journal of neurochemistry 2014 Apr;129(2):350-61
Journal of neurochemistry 2014 Apr;129(2):350-61
Interaction of transactive response DNA binding protein 43 with nuclear factor κB in mild cognitive impairment with episodic memory deficits.
Ohta Y, Tremblay C, Schneider JA, Bennett DA, Calon F, Julien JP
Acta neuropathologica communications 2014 Apr 1;2:37
Acta neuropathologica communications 2014 Apr 1;2:37
ALS-associated TDP-43 induces endoplasmic reticulum stress, which drives cytoplasmic TDP-43 accumulation and stress granule formation.
Walker AK, Soo KY, Sundaramoorthy V, Parakh S, Ma Y, Farg MA, Wallace RH, Crouch PJ, Turner BJ, Horne MK, Atkin JD
PloS one 2013;8(11):e81170
PloS one 2013;8(11):e81170
Reduced cholinergic olfactory centrifugal inputs in patients with neurodegenerative disorders and MPTP-treated monkeys.
Mundiñano IC, Hernandez M, Dicaudo C, Ordoñez C, Marcilla I, Tuñon MT, Luquin MR
Acta neuropathologica 2013 Sep;126(3):411-25
Acta neuropathologica 2013 Sep;126(3):411-25
Neurodegenerative disease status and post-mortem pathology in idiopathic rapid-eye-movement sleep behaviour disorder: an observational cohort study.
Iranzo A, Tolosa E, Gelpi E, Molinuevo JL, Valldeoriola F, Serradell M, Sanchez-Valle R, Vilaseca I, Lomeña F, Vilas D, Lladó A, Gaig C, Santamaria J
The Lancet. Neurology 2013 May;12(5):443-53
The Lancet. Neurology 2013 May;12(5):443-53
MAPT H1 haplotype is associated with enhanced α-synuclein deposition in dementia with Lewy bodies.
Colom-Cadena M, Gelpi E, Martí MJ, Charif S, Dols-Icardo O, Blesa R, Clarimón J, Lleó A
Neurobiology of aging 2013 Mar;34(3):936-42
Neurobiology of aging 2013 Mar;34(3):936-42
Characterization of thorn-shaped astrocytes in white matter of temporal lobe in Alzheimer's disease brains.
López-González I, Carmona M, Blanco R, Luna-Muñoz J, Martínez-Mandonado A, Mena R, Ferrer I
Brain pathology (Zurich, Switzerland) 2013 Mar;23(2):144-53
Brain pathology (Zurich, Switzerland) 2013 Mar;23(2):144-53
Reactive astrocytes secrete lcn2 to promote neuron death.
Bi F, Huang C, Tong J, Qiu G, Huang B, Wu Q, Li F, Xu Z, Bowser R, Xia XG, Zhou H
Proceedings of the National Academy of Sciences of the United States of America 2013 Mar 5;110(10):4069-74
Proceedings of the National Academy of Sciences of the United States of America 2013 Mar 5;110(10):4069-74
Primary progressive aphasia with parkinsonism.
Doherty KM, Rohrer JD, Lees AJ, Holton JL, Warren J
Movement disorders : official journal of the Movement Disorder Society 2013 Jun;28(6):741-6
Movement disorders : official journal of the Movement Disorder Society 2013 Jun;28(6):741-6
Asymptomatic hyper-creatine-kinase-emia as sole manifestation of inclusion body myositis.
Finsterer J, Stöllberger C, Kovacs GG
Neurology international 2013 Jun 25;5(2):34-6
Neurology international 2013 Jun 25;5(2):34-6
Selective forelimb impairment in rats expressing a pathological TDP-43 25 kDa C-terminal fragment to mimic amyotrophic lateral sclerosis.
Dayton RD, Gitcho MA, Orchard EA, Wilson JD, Wang DB, Cain CD, Johnson JA, Zhang YJ, Petrucelli L, Mathis JM, Klein RL
Molecular therapy : the journal of the American Society of Gene Therapy 2013 Jul;21(7):1324-34
Molecular therapy : the journal of the American Society of Gene Therapy 2013 Jul;21(7):1324-34
Globular glial-like inclusions in a patient with advanced Alzheimer's disease.
Gelpi E, Cullel F, Navarro-Otano J, Lladó A
Acta neuropathologica 2013 Jul;126(1):155-7
Acta neuropathologica 2013 Jul;126(1):155-7
The long non-coding RNA nuclear-enriched abundant transcript 1_2 induces paraspeckle formation in the motor neuron during the early phase of amyotrophic lateral sclerosis.
Nishimoto Y, Nakagawa S, Hirose T, Okano HJ, Takao M, Shibata S, Suyama S, Kuwako K, Imai T, Murayama S, Suzuki N, Okano H
Molecular brain 2013 Jul 8;6:31
Molecular brain 2013 Jul 8;6:31
Expression of ALS-linked TDP-43 mutant in astrocytes causes non-cell-autonomous motor neuron death in rats.
Tong J, Huang C, Bi F, Wu Q, Huang B, Liu X, Li F, Zhou H, Xia XG
The EMBO journal 2013 Jul 3;32(13):1917-26
The EMBO journal 2013 Jul 3;32(13):1917-26
Parkin ubiquitinates Tar-DNA binding protein-43 (TDP-43) and promotes its cytosolic accumulation via interaction with histone deacetylase 6 (HDAC6).
Hebron ML, Lonskaya I, Sharpe K, Weerasinghe PP, Algarzae NK, Shekoyan AR, Moussa CE
The Journal of biological chemistry 2013 Feb 8;288(6):4103-15
The Journal of biological chemistry 2013 Feb 8;288(6):4103-15
Accelerated disease onset with stabilized familial amyotrophic lateral sclerosis (ALS)-linked mutant TDP-43 proteins.
Watanabe S, Kaneko K, Yamanaka K
The Journal of biological chemistry 2013 Feb 1;288(5):3641-54
The Journal of biological chemistry 2013 Feb 1;288(5):3641-54
Prominent psychiatric symptoms in patients with Parkinson's disease and concomitant argyrophilic grain disease.
Grau-Rivera O, Gelpi E, Rey MJ, Valldeoriola F, Tolosa E, Compta Y, Martí MJ
Journal of neurology 2013 Dec;260(12):3002-9
Journal of neurology 2013 Dec;260(12):3002-9
Atypical neuropathological sCJD-MM phenotype with abundant white matter Kuru-type plaques sparing the cerebellar cortex.
Gelpi E, Soler Insa JM, Parchi P, Saverioni D, Yagüe J, Nos C, Martínez-Saez E, Ribalta T, Ferrer I, Sanchez-Valle R
Neuropathology : official journal of the Japanese Society of Neuropathology 2013 Apr;33(2):204-8
Neuropathology : official journal of the Japanese Society of Neuropathology 2013 Apr;33(2):204-8
Co-occurrence of different pathologies in dementia: implications for dementia diagnosis.
Echávarri C, Burgmans S, Caballero MC, García-Bragado F, Verhey FR, Uylings HB
Journal of Alzheimer's disease : JAD 2012;30(4):909-17
Journal of Alzheimer's disease : JAD 2012;30(4):909-17
Breakpoint sequence analysis of an AβPP locus duplication associated with autosomal dominant Alzheimer's disease and severe cerebral amyloid angiopathy.
Antonell A, Gelpi E, Sánchez-Valle R, Martínez R, Molinuevo JL, Lladó A
Journal of Alzheimer's disease : JAD 2012;28(2):303-8
Journal of Alzheimer's disease : JAD 2012;28(2):303-8
TDP-43 plasma levels are higher in amyotrophic lateral sclerosis.
Verstraete E, Kuiperij HB, van Blitterswijk MM, Veldink JH, Schelhaas HJ, van den Berg LH, Verbeek MM
Amyotrophic lateral sclerosis : official publication of the World Federation of Neurology Research Group on Motor Neuron Diseases 2012 Sep;13(5):446-51
Amyotrophic lateral sclerosis : official publication of the World Federation of Neurology Research Group on Motor Neuron Diseases 2012 Sep;13(5):446-51
An MND/ALS phenotype associated with C9orf72 repeat expansion: abundant p62-positive, TDP-43-negative inclusions in cerebral cortex, hippocampus and cerebellum but without associated cognitive decline.
Troakes C, Maekawa S, Wijesekera L, Rogelj B, Siklós L, Bell C, Smith B, Newhouse S, Vance C, Johnson L, Hortobágyi T, Shatunov A, Al-Chalabi A, Leigh N, Shaw CE, King A, Al-Sarraj S
Neuropathology : official journal of the Japanese Society of Neuropathology 2012 Oct;32(5):505-14
Neuropathology : official journal of the Japanese Society of Neuropathology 2012 Oct;32(5):505-14
XBP1 depletion precedes ubiquitin aggregation and Golgi fragmentation in TDP-43 transgenic rats.
Tong J, Huang C, Bi F, Wu Q, Huang B, Zhou H
Journal of neurochemistry 2012 Nov;123(3):406-16
Journal of neurochemistry 2012 Nov;123(3):406-16
Wild type TDP-43 induces neuro-inflammation and alters APP metabolism in lentiviral gene transfer models.
Herman AM, Khandelwal PJ, Rebeck GW, Moussa CE
Experimental neurology 2012 May;235(1):297-305
Experimental neurology 2012 May;235(1):297-305
TDP-43 regulates global translational yield by splicing of exon junction complex component SKAR.
Fiesel FC, Weber SS, Supper J, Zell A, Kahle PJ
Nucleic acids research 2012 Mar;40(6):2668-82
Nucleic acids research 2012 Mar;40(6):2668-82
Identification of c-myc-dependent proteins in the medulloblastoma cell line D425Med.
Azizi AA, Li L, Ströbel T, Chen WQ, Slavc I, Lubec G
Amino acids 2012 Jun;42(6):2149-63
Amino acids 2012 Jun;42(6):2149-63
Mutant TDP-43 in motor neurons promotes the onset and progression of ALS in rats.
Huang C, Tong J, Bi F, Zhou H, Xia XG
The Journal of clinical investigation 2012 Jan;122(1):107-18
The Journal of clinical investigation 2012 Jan;122(1):107-18
Epitope mapping of antibodies against TDP-43 and detection of protease-resistant fragments of pathological TDP-43 in amyotrophic lateral sclerosis and frontotemporal lobar degeneration.
Tsuji H, Nonaka T, Yamashita M, Masuda-Suzukake M, Kametani F, Akiyama H, Mann DM, Tamaoka A, Hasegawa M
Biochemical and biophysical research communications 2012 Jan 6;417(1):116-21
Biochemical and biophysical research communications 2012 Jan 6;417(1):116-21
Unusual clinical presentation and neuropathology in two subjects with fused-in sarcoma (FUS) positive inclusions.
Hartikainen PH, Pikkarainen M, Hänninen T, Soininen H, Alafuzoff I
Neuropathology : official journal of the Japanese Society of Neuropathology 2012 Feb;32(1):60-8
Neuropathology : official journal of the Japanese Society of Neuropathology 2012 Feb;32(1):60-8
Frontotemporal lobar degeneration-related proteins induce only subtle memory-related deficits when bilaterally overexpressed in the dorsal hippocampus.
Dayton RD, Wang DB, Cain CD, Schrott LM, Ramirez JJ, King MA, Klein RL
Experimental neurology 2012 Feb;233(2):807-14
Experimental neurology 2012 Feb;233(2):807-14
Pick's pathology in Parkinson's disease with dementia.
Vilas D, Marti MJ, Botta-Orfila T, Colom-Cadena M, Gelpi E
Neuropathology and applied neurobiology 2012 Dec;38(7):737-43
Neuropathology and applied neurobiology 2012 Dec;38(7):737-43
Abnormal regenerative responses and impaired axonal outgrowth after nerve crush in TDP-43 transgenic mouse models of amyotrophic lateral sclerosis.
Swarup V, Audet JN, Phaneuf D, Kriz J, Julien JP
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Dec 12;32(50):18186-95
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Dec 12;32(50):18186-95
Hirano body-rich subtypes of Creutzfeldt-Jakob disease.
Martinez-Saez E, Gelpi E, Rey MJ, Ferrer I, Ribalta T, Botta-Orfila T, Nos C, Yagüe J, Sanchez-Valle R
Neuropathology and applied neurobiology 2012 Apr;38(2):153-61
Neuropathology and applied neurobiology 2012 Apr;38(2):153-61
Pathological hallmarks of amyotrophic lateral sclerosis/frontotemporal lobar degeneration in transgenic mice produced with TDP-43 genomic fragments.
Swarup V, Phaneuf D, Bareil C, Robertson J, Rouleau GA, Kriz J, Julien JP
Brain : a journal of neurology 2011 Sep;134(Pt 9):2610-26
Brain : a journal of neurology 2011 Sep;134(Pt 9):2610-26
Neurofibrillary tangle pathology and Braak staging in chronic epilepsy in relation to traumatic brain injury and hippocampal sclerosis: a post-mortem study.
Thom M, Liu JY, Thompson P, Phadke R, Narkiewicz M, Martinian L, Marsdon D, Koepp M, Caboclo L, Catarino CB, Sisodiya SM
Brain : a journal of neurology 2011 Oct;134(Pt 10):2969-81
Brain : a journal of neurology 2011 Oct;134(Pt 10):2969-81
The ALS-associated proteins FUS and TDP-43 function together to affect Drosophila locomotion and life span.
Wang JW, Brent JR, Tomlinson A, Shneider NA, McCabe BD
The Journal of clinical investigation 2011 Oct;121(10):4118-26
The Journal of clinical investigation 2011 Oct;121(10):4118-26
Cytoplasmic accumulation of TDP-43 in circulating lymphomonocytes of ALS patients with and without TARDBP mutations.
De Marco G, Lupino E, Calvo A, Moglia C, Buccinnà B, Grifoni S, Ramondetti C, Lomartire A, Rinaudo MT, Piccinini M, Giordana MT, Chiò A
Acta neuropathologica 2011 May;121(5):611-22
Acta neuropathologica 2011 May;121(5):611-22
TAR-DNA binding protein-43 and alterations in the hippocampus.
Rauramaa T, Pikkarainen M, Englund E, Ince PG, Jellinger K, Paetau A, Alafuzoff I
Journal of neural transmission (Vienna, Austria : 1996) 2011 May;118(5):683-9
Journal of neural transmission (Vienna, Austria : 1996) 2011 May;118(5):683-9
FTLD-TDP with motor neuron disease, visuospatial impairment and a progressive supranuclear palsy-like syndrome: broadening the clinical phenotype of TDP-43 proteinopathies. A report of three cases.
Rusina R, Kovacs GG, Fiala J, Hort J, Ridzoň P, Holmerová I, Ströbel T, Matěj R
BMC neurology 2011 May 10;11:50
BMC neurology 2011 May 10;11:50
TDP-43 potentiates alpha-synuclein toxicity to dopaminergic neurons in transgenic mice.
Tian T, Huang C, Tong J, Yang M, Zhou H, Xia XG
International journal of biological sciences 2011 Mar 4;7(2):234-43
International journal of biological sciences 2011 Mar 4;7(2):234-43
Aggregation of the 35-kDa fragment of TDP-43 causes formation of cytoplasmic inclusions and alteration of RNA processing.
Che MX, Jiang YJ, Xie YY, Jiang LL, Hu HY
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Jul;25(7):2344-53
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Jul;25(7):2344-53
Increased dopaminergic cells and protein aggregates in the olfactory bulb of patients with neurodegenerative disorders.
Mundiñano IC, Caballero MC, Ordóñez C, Hernandez M, DiCaudo C, Marcilla I, Erro ME, Tuñon MT, Luquin MR
Acta neuropathologica 2011 Jul;122(1):61-74
Acta neuropathologica 2011 Jul;122(1):61-74
Distribution and pattern of pathology in subjects with familial or sporadic late-onset cerebellar ataxia as assessed by p62/sequestosome immunohistochemistry.
Pikkarainen M, Hartikainen P, Soininen H, Alafuzoff I
Cerebellum (London, England) 2011 Dec;10(4):720-31
Cerebellum (London, England) 2011 Dec;10(4):720-31
Molecular mechanisms of MLC1 and GLIALCAM mutations in megalencephalic leukoencephalopathy with subcortical cysts.
López-Hernández T, Sirisi S, Capdevila-Nortes X, Montolio M, Fernández-Dueñas V, Scheper GC, van der Knaap MS, Casquero P, Ciruela F, Ferrer I, Nunes V, Estévez R
Human molecular genetics 2011 Aug 15;20(16):3266-77
Human molecular genetics 2011 Aug 15;20(16):3266-77
TDP-43 pathology may occur in the BRI2 gene-related dementias.
Lashley T, Holton JL, Revesz T
Acta neuropathologica 2011 Apr;121(4):559-60
Acta neuropathologica 2011 Apr;121(4):559-60
β-amyloid triggers ALS-associated TDP-43 pathology in AD models.
Herman AM, Khandelwal PJ, Stanczyk BB, Rebeck GW, Moussa CE
Brain research 2011 Apr 22;1386:191-9
Brain research 2011 Apr 22;1386:191-9
The first case of protease-sensitive prionopathy (PSPr) in The Netherlands: a patient with an unusual GSS-like clinical phenotype.
Jansen C, Head MW, van Gool WA, Baas F, Yull H, Ironside JW, Rozemuller AJ
Journal of neurology, neurosurgery, and psychiatry 2010 Sep;81(9):1052-5
Journal of neurology, neurosurgery, and psychiatry 2010 Sep;81(9):1052-5
Tubulin polymerization promoting protein (TPPP/p25) as a marker for oligodendroglial changes in multiple sclerosis.
Höftberger R, Fink S, Aboul-Enein F, Botond G, Olah J, Berki T, Ovadi J, Lassmann H, Budka H, Kovacs GG
Glia 2010 Nov 15;58(15):1847-57
Glia 2010 Nov 15;58(15):1847-57
Depletion of oxidative and endoplasmic reticulum stress regulators in Pick disease.
Ilieva EV, Naudí A, Kichev A, Ferrer I, Pamplona R, Portero-Otín M
Free radical biology & medicine 2010 May 15;48(10):1302-10
Free radical biology & medicine 2010 May 15;48(10):1302-10
Mutations of optineurin in amyotrophic lateral sclerosis.
Maruyama H, Morino H, Ito H, Izumi Y, Kato H, Watanabe Y, Kinoshita Y, Kamada M, Nodera H, Suzuki H, Komure O, Matsuura S, Kobatake K, Morimoto N, Abe K, Suzuki N, Aoki M, Kawata A, Hirai T, Kato T, Ogasawara K, Hirano A, Takumi T, Kusaka H, Hagiwara K, Kaji R, Kawakami H
Nature 2010 May 13;465(7295):223-6
Nature 2010 May 13;465(7295):223-6
Amyotrophic lateral sclerosis: dash-like accumulation of phosphorylated TDP-43 in somatodendritic and axonal compartments of somatomotor neurons of the lower brainstem and spinal cord.
Braak H, Ludolph A, Thal DR, Del Tredici K
Acta neuropathologica 2010 Jul;120(1):67-74
Acta neuropathologica 2010 Jul;120(1):67-74
ALS-associated mutations in TDP-43 increase its stability and promote TDP-43 complexes with FUS/TLS.
Ling SC, Albuquerque CP, Han JS, Lagier-Tourenne C, Tokunaga S, Zhou H, Cleveland DW
Proceedings of the National Academy of Sciences of the United States of America 2010 Jul 27;107(30):13318-23
Proceedings of the National Academy of Sciences of the United States of America 2010 Jul 27;107(30):13318-23
Knockdown of transactive response DNA-binding protein (TDP-43) downregulates histone deacetylase 6.
Fiesel FC, Voigt A, Weber SS, Van den Haute C, Waldenmaier A, Görner K, Walter M, Anderson ML, Kern JV, Rasse TM, Schmidt T, Springer W, Kirchner R, Bonin M, Neumann M, Baekelandt V, Alunni-Fabbroni M, Schulz JB, Kahle PJ
The EMBO journal 2010 Jan 6;29(1):209-21
The EMBO journal 2010 Jan 6;29(1):209-21
Characterization of alternative isoforms and inclusion body of the TAR DNA-binding protein-43.
Nishimoto Y, Ito D, Yagi T, Nihei Y, Tsunoda Y, Suzuki N
The Journal of biological chemistry 2010 Jan 1;285(1):608-19
The Journal of biological chemistry 2010 Jan 1;285(1):608-19
TDP-43 transgenic mice develop spastic paralysis and neuronal inclusions characteristic of ALS and frontotemporal lobar degeneration.
Wils H, Kleinberger G, Janssens J, Pereson S, Joris G, Cuijt I, Smits V, Ceuterick-de Groote C, Van Broeckhoven C, Kumar-Singh S
Proceedings of the National Academy of Sciences of the United States of America 2010 Feb 23;107(8):3858-63
Proceedings of the National Academy of Sciences of the United States of America 2010 Feb 23;107(8):3858-63
TDP-43 physically interacts with amyotrophic lateral sclerosis-linked mutant CuZn superoxide dismutase.
Higashi S, Tsuchiya Y, Araki T, Wada K, Kabuta T
Neurochemistry international 2010 Dec;57(8):906-13
Neurochemistry international 2010 Dec;57(8):906-13
Expansive gene transfer in the rat CNS rapidly produces amyotrophic lateral sclerosis relevant sequelae when TDP-43 is overexpressed.
Wang DB, Dayton RD, Henning PP, Cain CD, Zhao LR, Schrott LM, Orchard EA, Knight DS, Klein RL
Molecular therapy : the journal of the American Society of Gene Therapy 2010 Dec;18(12):2064-74
Molecular therapy : the journal of the American Society of Gene Therapy 2010 Dec;18(12):2064-74
Neurotoxic effects of TDP-43 overexpression in C. elegans.
Ash PE, Zhang YJ, Roberts CM, Saldi T, Hutter H, Buratti E, Petrucelli L, Link CD
Human molecular genetics 2010 Aug 15;19(16):3206-18
Human molecular genetics 2010 Aug 15;19(16):3206-18
Wild-type human TDP-43 expression causes TDP-43 phosphorylation, mitochondrial aggregation, motor deficits, and early mortality in transgenic mice.
Xu YF, Gendron TF, Zhang YJ, Lin WL, D'Alton S, Sheng H, Casey MC, Tong J, Knight J, Yu X, Rademakers R, Boylan K, Hutton M, McGowan E, Dickson DW, Lewis J, Petrucelli L
The Journal of neuroscience : the official journal of the Society for Neuroscience 2010 Aug 11;30(32):10851-9
The Journal of neuroscience : the official journal of the Society for Neuroscience 2010 Aug 11;30(32):10851-9
Alteration of biochemical and pathological properties of TDP-43 protein by a lipid mediator, 15-deoxy-Delta(12,14)-prostaglandin J(2).
Zhang HX, Tanji K, Yoshida H, Hayakari M, Shibata T, Mori F, Uchida K, Wakabayashi K
Experimental neurology 2010 Apr;222(2):296-303
Experimental neurology 2010 Apr;222(2):296-303
Plasma phosphorylated-TDP-43 protein levels correlate with brain pathology in frontotemporal lobar degeneration.
Foulds PG, Davidson Y, Mishra M, Hobson DJ, Humphreys KM, Taylor M, Johnson N, Weintraub S, Akiyama H, Arai T, Hasegawa M, Bigio EH, Benson FE, Allsop D, Mann DM
Acta neuropathologica 2009 Nov;118(5):647-58
Acta neuropathologica 2009 Nov;118(5):647-58
Cytosolic TDP-43 expression following axotomy is associated with caspase 3 activation in NFL-/- mice: support for a role for TDP-43 in the physiological response to neuronal injury.
Moisse K, Mepham J, Volkening K, Welch I, Hill T, Strong MJ
Brain research 2009 Nov 3;1296:176-86
Brain research 2009 Nov 3;1296:176-86
The complement factor C5a receptor is upregulated in NFL-/- mouse motor neurons.
Humayun S, Gohar M, Volkening K, Moisse K, Leystra-Lantz C, Mepham J, McLean J, Strong MJ
Journal of neuroimmunology 2009 May 29;210(1-2):52-62
Journal of neuroimmunology 2009 May 29;210(1-2):52-62
VCP mutations causing frontotemporal lobar degeneration disrupt localization of TDP-43 and induce cell death.
Gitcho MA, Strider J, Carter D, Taylor-Reinwald L, Forman MS, Goate AM, Cairns NJ
The Journal of biological chemistry 2009 May 1;284(18):12384-98
The Journal of biological chemistry 2009 May 1;284(18):12384-98
TAR DNA-Binding protein 43 accumulation in protein aggregate myopathies.
Olivé M, Janué A, Moreno D, Gámez J, Torrejón-Escribano B, Ferrer I
Journal of neuropathology and experimental neurology 2009 Mar;68(3):262-73
Journal of neuropathology and experimental neurology 2009 Mar;68(3):262-73
Expression of TDP-43 C-terminal Fragments in Vitro Recapitulates Pathological Features of TDP-43 Proteinopathies.
Igaz LM, Kwong LK, Chen-Plotkin A, Winton MJ, Unger TL, Xu Y, Neumann M, Trojanowski JQ, Lee VM
The Journal of biological chemistry 2009 Mar 27;284(13):8516-24
The Journal of biological chemistry 2009 Mar 27;284(13):8516-24
Early-onset familial lewy body dementia with extensive tauopathy: a clinical, genetic, and neuropathological study.
Clarimón J, Molina-Porcel L, Gómez-Isla T, Blesa R, Guardia-Laguarta C, González-Neira A, Estorch M, Ma Grau J, Barraquer L, Roig C, Ferrer I, Lleó A
Journal of neuropathology and experimental neurology 2009 Jan;68(1):73-82
Journal of neuropathology and experimental neurology 2009 Jan;68(1):73-82
Increased TDP-43 protein in cerebrospinal fluid of patients with amyotrophic lateral sclerosis.
Kasai T, Tokuda T, Ishigami N, Sasayama H, Foulds P, Mitchell DJ, Mann DM, Allsop D, Nakagawa M
Acta neuropathologica 2009 Jan;117(1):55-62
Acta neuropathologica 2009 Jan;117(1):55-62
Sporadic amyotrophic lateral sclerosis of long duration is associated with relatively mild TDP-43 pathology.
Nishihira Y, Tan CF, Hoshi Y, Iwanaga K, Yamada M, Kawachi I, Tsujihata M, Hozumi I, Morita T, Onodera O, Nishizawa M, Kakita A, Takahashi H
Acta neuropathologica 2009 Jan;117(1):45-53
Acta neuropathologica 2009 Jan;117(1):45-53
Expression of collagen XVII and ubiquitin-binding protein p62 in motor neuron disease.
Seppänen A, Pikkarainen M, Hartikainen P, Hofmann SC, Majamaa K, Alafuzoff I
Brain research 2009 Jan 9;1247:171-7
Brain research 2009 Jan 9;1247:171-7
Divergent patterns of cytosolic TDP-43 and neuronal progranulin expression following axotomy: implications for TDP-43 in the physiological response to neuronal injury.
Moisse K, Volkening K, Leystra-Lantz C, Welch I, Hill T, Strong MJ
Brain research 2009 Jan 16;1249:202-11
Brain research 2009 Jan 16;1249:202-11
Frontotemporal dementia in a large Swedish family is caused by a progranulin null mutation.
Skoglund L, Brundin R, Olofsson T, Kalimo H, Ingvast S, Blom ES, Giedraitis V, Ingelsson M, Lannfelt L, Basun H, Glaser A
Neurogenetics 2009 Feb;10(1):27-34
Neurogenetics 2009 Feb;10(1):27-34
Abnormal hippocampal distribution of TDP-43 in patients with-late onset psychosis.
Velakoulis D, Walterfang M, Mocellin R, Pantelis C, Dean B, McLean C
The Australian and New Zealand journal of psychiatry 2009 Aug;43(8):739-45
The Australian and New Zealand journal of psychiatry 2009 Aug;43(8):739-45
Ubiquitin associated protein 1 is a risk factor for frontotemporal lobar degeneration.
Rollinson S, Rizzu P, Sikkink S, Baker M, Halliwell N, Snowden J, Traynor BJ, Ruano D, Cairns N, Rohrer JD, Mead S, Collinge J, Rossor M, Akay E, Guerreiro R, Rademakers R, Morrison KE, Pastor P, Alonso E, Martinez-Lage P, Graff-Radford N, Neary D, Heutink P, Mann DM, Van Swieten J, Pickering-Brown SM
Neurobiology of aging 2009 Apr;30(4):656-65
Neurobiology of aging 2009 Apr;30(4):656-65
Frontotemporal dementia presenting as schizophrenia-like psychosis in young people: clinicopathological series and review of cases.
Velakoulis D, Walterfang M, Mocellin R, Pantelis C, McLean C
The British journal of psychiatry : the journal of mental science 2009 Apr;194(4):298-305
The British journal of psychiatry : the journal of mental science 2009 Apr;194(4):298-305
TDP-43 accumulation in inclusion body myopathy muscle suggests a common pathogenic mechanism with frontotemporal dementia.
Weihl CC, Temiz P, Miller SE, Watts G, Smith C, Forman M, Hanson PI, Kimonis V, Pestronk A
Journal of neurology, neurosurgery, and psychiatry 2008 Oct;79(10):1186-9
Journal of neurology, neurosurgery, and psychiatry 2008 Oct;79(10):1186-9
White matter tauopathy with globular glial inclusions: a distinct sporadic frontotemporal lobar degeneration.
Kovacs GG, Majtenyi K, Spina S, Murrell JR, Gelpi E, Hoftberger R, Fraser G, Crowther RA, Goedert M, Budka H, Ghetti B
Journal of neuropathology and experimental neurology 2008 Oct;67(10):963-75
Journal of neuropathology and experimental neurology 2008 Oct;67(10):963-75
TDP-43 in cerebrospinal fluid of patients with frontotemporal lobar degeneration and amyotrophic lateral sclerosis.
Steinacker P, Hendrich C, Sperfeld AD, Jesse S, von Arnim CA, Lehnert S, Pabst A, Uttner I, Tumani H, Lee VM, Trojanowski JQ, Kretzschmar HA, Ludolph A, Neumann M, Otto M
Archives of neurology 2008 Nov;65(11):1481-7
Archives of neurology 2008 Nov;65(11):1481-7
Disturbance of nuclear and cytoplasmic TAR DNA-binding protein (TDP-43) induces disease-like redistribution, sequestration, and aggregate formation.
Winton MJ, Igaz LM, Wong MM, Kwong LK, Trojanowski JQ, Lee VM
The Journal of biological chemistry 2008 May 9;283(19):13302-9
The Journal of biological chemistry 2008 May 9;283(19):13302-9
A distinct clinical, neuropsychological and radiological phenotype is associated with progranulin gene mutations in a large UK series.
Beck J, Rohrer JD, Campbell T, Isaacs A, Morrison KE, Goodall EF, Warrington EK, Stevens J, Revesz T, Holton J, Al-Sarraj S, King A, Scahill R, Warren JD, Fox NC, Rossor MN, Collinge J, Mead S
Brain : a journal of neurology 2008 Mar;131(Pt 3):706-20
Brain : a journal of neurology 2008 Mar;131(Pt 3):706-20
Epitope mapping of 2E2-D3, a monoclonal antibody directed against human TDP-43.
Zhang HX, Tanji K, Mori F, Wakabayashi K
Neuroscience letters 2008 Mar 28;434(2):170-4
Neuroscience letters 2008 Mar 28;434(2):170-4
Molecular pathogenesis of frontotemporal lobar degeneration: basic science seminar in neurology.
Sleegers K, Kumar-Singh S, Cruts M, Van Broeckhoven C
Archives of neurology 2008 Jun;65(6):700-4
Archives of neurology 2008 Jun;65(6):700-4
Enrichment of C-terminal fragments in TAR DNA-binding protein-43 cytoplasmic inclusions in brain but not in spinal cord of frontotemporal lobar degeneration and amyotrophic lateral sclerosis.
Igaz LM, Kwong LK, Xu Y, Truax AC, Uryu K, Neumann M, Clark CM, Elman LB, Miller BL, Grossman M, McCluskey LF, Trojanowski JQ, Lee VM
The American journal of pathology 2008 Jul;173(1):182-94
The American journal of pathology 2008 Jul;173(1):182-94
MAPT S305I mutation: implications for argyrophilic grain disease.
Kovacs GG, Pittman A, Revesz T, Luk C, Lees A, Kiss E, Tariska P, Laszlo L, Molnár K, Molnar MJ, Tolnay M, de Silva R
Acta neuropathologica 2008 Jul;116(1):103-18
Acta neuropathologica 2008 Jul;116(1):103-18
TDP-43-immunoreactive neuronal and glial inclusions in the neostriatum in amyotrophic lateral sclerosis with and without dementia.
Zhang H, Tan CF, Mori F, Tanji K, Kakita A, Takahashi H, Wakabayashi K
Acta neuropathologica 2008 Jan;115(1):115-22
Acta neuropathologica 2008 Jan;115(1):115-22
Missense mutations in the progranulin gene linked to frontotemporal lobar degeneration with ubiquitin-immunoreactive inclusions reduce progranulin production and secretion.
Shankaran SS, Capell A, Hruscha AT, Fellerer K, Neumann M, Schmid B, Haass C
The Journal of biological chemistry 2008 Jan 18;283(3):1744-53
The Journal of biological chemistry 2008 Jan 18;283(3):1744-53
Colocalization of transactivation-responsive DNA-binding protein 43 and huntingtin in inclusions of Huntington disease.
Schwab C, Arai T, Hasegawa M, Yu S, McGeer PL
Journal of neuropathology and experimental neurology 2008 Dec;67(12):1159-65
Journal of neuropathology and experimental neurology 2008 Dec;67(12):1159-65
Enduring involvement of tau, beta-amyloid, alpha-synuclein, ubiquitin and TDP-43 pathology in the amyotrophic lateral sclerosis/parkinsonism-dementia complex of Guam (ALS/PDC).
Miklossy J, Steele JC, Yu S, McCall S, Sandberg G, McGeer EG, McGeer PL
Acta neuropathologica 2008 Dec;116(6):625-37
Acta neuropathologica 2008 Dec;116(6):625-37
Ultrastructural localization of TDP-43 in filamentous neuronal inclusions in various neurodegenerative diseases.
Lin WL, Dickson DW
Acta neuropathologica 2008 Aug;116(2):205-13
Acta neuropathologica 2008 Aug;116(2):205-13
Maturation process of TDP-43-positive neuronal cytoplasmic inclusions in amyotrophic lateral sclerosis with and without dementia.
Mori F, Tanji K, Zhang HX, Nishihira Y, Tan CF, Takahashi H, Wakabayashi K
Acta neuropathologica 2008 Aug;116(2):193-203
Acta neuropathologica 2008 Aug;116(2):193-203
TDP-43 protein in plasma may index TDP-43 brain pathology in Alzheimer's disease and frontotemporal lobar degeneration.
Foulds P, McAuley E, Gibbons L, Davidson Y, Pickering-Brown SM, Neary D, Snowden JS, Allsop D, Mann DM
Acta neuropathologica 2008 Aug;116(2):141-6
Acta neuropathologica 2008 Aug;116(2):141-6
A yeast TDP-43 proteinopathy model: Exploring the molecular determinants of TDP-43 aggregation and cellular toxicity.
Johnson BS, McCaffery JM, Lindquist S, Gitler AD
Proceedings of the National Academy of Sciences of the United States of America 2008 Apr 29;105(17):6439-44
Proceedings of the National Academy of Sciences of the United States of America 2008 Apr 29;105(17):6439-44
DEAD-box RNA helicase subunits of the Drosha complex are required for processing of rRNA and a subset of microRNAs.
Fukuda T, Yamagata K, Fujiyama S, Matsumoto T, Koshida I, Yoshimura K, Mihara M, Naitou M, Endoh H, Nakamura T, Akimoto C, Yamamoto Y, Katagiri T, Foulds C, Takezawa S, Kitagawa H, Takeyama K, O'Malley BW, Kato S
Nature cell biology 2007 May;9(5):604-11
Nature cell biology 2007 May;9(5):604-11
TDP-43 immunoreactivity in hippocampal sclerosis and Alzheimer's disease.
Amador-Ortiz C, Lin WL, Ahmed Z, Personett D, Davies P, Duara R, Graff-Radford NR, Hutton ML, Dickson DW
Annals of neurology 2007 May;61(5):435-45
Annals of neurology 2007 May;61(5):435-45
Pathological TDP-43 distinguishes sporadic amyotrophic lateral sclerosis from amyotrophic lateral sclerosis with SOD1 mutations.
Mackenzie IR, Bigio EH, Ince PG, Geser F, Neumann M, Cairns NJ, Kwong LK, Forman MS, Ravits J, Stewart H, Eisen A, McClusky L, Kretzschmar HA, Monoranu CM, Highley JR, Kirby J, Siddique T, Shaw PJ, Lee VM, Trojanowski JQ
Annals of neurology 2007 May;61(5):427-34
Annals of neurology 2007 May;61(5):427-34
TDP-43 is deposited in the Guam parkinsonism-dementia complex brains.
Hasegawa M, Arai T, Akiyama H, Nonaka T, Mori H, Hashimoto T, Yamazaki M, Oyanagi K
Brain : a journal of neurology 2007 May;130(Pt 5):1386-94
Brain : a journal of neurology 2007 May;130(Pt 5):1386-94
TDP-43 immunoreactivity in neuronal inclusions in familial amyotrophic lateral sclerosis with or without SOD1 gene mutation.
Tan CF, Eguchi H, Tagawa A, Onodera O, Iwasaki T, Tsujino A, Nishizawa M, Kakita A, Takahashi H
Acta neuropathologica 2007 May;113(5):535-42
Acta neuropathologica 2007 May;113(5):535-42
TDP-43-positive white matter pathology in frontotemporal lobar degeneration with ubiquitin-positive inclusions.
Neumann M, Kwong LK, Truax AC, Vanmassenhove B, Kretzschmar HA, Van Deerlin VM, Clark CM, Grossman M, Miller BL, Trojanowski JQ, Lee VM
Journal of neuropathology and experimental neurology 2007 Mar;66(3):177-83
Journal of neuropathology and experimental neurology 2007 Mar;66(3):177-83
TDP-43 in the ubiquitin pathology of frontotemporal dementia with VCP gene mutations.
Neumann M, Mackenzie IR, Cairns NJ, Boyer PJ, Markesbery WR, Smith CD, Taylor JP, Kretzschmar HA, Kimonis VE, Forman MS
Journal of neuropathology and experimental neurology 2007 Feb;66(2):152-7
Journal of neuropathology and experimental neurology 2007 Feb;66(2):152-7
Evidence that TDP-43 is not the major ubiquitinated target within the pathological inclusions of amyotrophic lateral sclerosis.
Sanelli T, Xiao S, Horne P, Bilbao J, Zinman L, Robertson J
Journal of neuropathology and experimental neurology 2007 Dec;66(12):1147-53
Journal of neuropathology and experimental neurology 2007 Dec;66(12):1147-53
TDP-43 is a component of ubiquitin-positive tau-negative inclusions in frontotemporal lobar degeneration and amyotrophic lateral sclerosis.
Arai T, Hasegawa M, Akiyama H, Ikeda K, Nonaka T, Mori H, Mann D, Tsuchiya K, Yoshida M, Hashizume Y, Oda T
Biochemical and biophysical research communications 2006 Dec 22;351(3):602-11
Biochemical and biophysical research communications 2006 Dec 22;351(3):602-11
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TARDBP monoclonal antibody (M01), clone 2E2-D3 Western Blot analysis of TARDBP expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TARDBP expression in transfected 293T cell line by TARDBP monoclonal antibody (M01), clone 2E2-D3.Lane 1: TARDBP transfected lysate(44.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TARDBP is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TARDBP on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of TARDBP transfected lysate using anti-TARDBP monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TARDBP MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TARDBP on formalin-fixed paraffin-embedded human leiomyosarcoma tissue [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol