HPA017284

TARDBP antibody from Atlas Antibodies
ALS10, TDP-43
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017284
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017284, RRID:AB_1235836
Product name
Anti-TARDBP
Provider product page
Atlas Antibodies - HPA017284
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNS
NRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGN
NQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGM
MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGN
N
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -