H00009096-M08

TBX18 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00009096-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009096-M08, RRID:AB_1205060
Product name
TBX18 monoclonal antibody (M08), clone 3G2
Provider product page
Abnova Corporation - H00009096-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TBX18.
Antigen sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNT
SQLCSLAPADYSACARSGLTLNRYSTSLAETYNRL
TNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGD
TF
Isotype
IgG
Antibody clone number
3G2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -