HPA008297

RPN2 antibody from Atlas Antibodies
RIBIIR, RPN-II, RPNII, SWP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008297
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008297, RRID:AB_1856457
Product name
Anti-RPN2
Provider product page
Atlas Antibodies - HPA008297
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGL
PLASQEALSALTARLSKEETVLATVQALQTASHLS
QQADLRSIVEEIEDLVARLDELGGVYLQFEEGLET
TALFVAATYKLMDHVGTE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -