HPA008297

RPN2 antibody from Atlas Antibodies
RIBIIR, RPN-II, RPNII, SWP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008297
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008297, RRID:AB_1235448
Product name
Anti-RPN2
Provider product page
Atlas Antibodies - HPA008297
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGL
PLASQEALSALTARLSKEETVLATVQALQTASHLS
QQADLRSIVEEIEDLVARLDELGGVYLQFEEGLET
TALFVAATYKLMDHVGTE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -