HPA008297

RPN2 antibody from Sigma-Aldrich
RIBIIR, RPN-II, RPNII, SWP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008297
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008297, RRID:AB_1856457
Product name
Anti-RPN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008297
Antibody type
Polyclonal
Antigen
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGL
PLASQEALSALTARLSKEETVLATVQALQTASHLS
QQADLRSIVEEIEDLVARLDELGGVYLQFEEGLET
TALFVAATYKLMDHVGTE
Storage
-20C
Provider Type Product Number
- No reagents -