Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [4]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023075-M09 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023075-M09, RRID:AB_535064
- Product name
- SWAP70 monoclonal antibody (M09), clone 3H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SWAP70.
- Antigen sequence
QTQVELQARFSTELEREKLIRQQMEEQVAQKSSEL
EQYLQRVRELEDMYLKLQEALEDERQARQDEETVR
KLQA- Isotype
- IgG
- Antibody clone number
- 3H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SWAP70 monoclonal antibody (M09), clone 3H8. Western Blot analysis of SWAP70 expression in Raw 264.7.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SWAP70 expression in transfected 293T cell line by SWAP70 monoclonal antibody (M09), clone 3H8.Lane 1: SWAP70 transfected lysate(69 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SWAP70 monoclonal antibody (M09), clone 3H8. Western Blot analysis of SWAP70 expression in PC-12(Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SWAP70 monoclonal antibody (M09), clone 3H8. Western Blot analysis of SWAP70 expression in human spleen.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SWAP70 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SWAP70 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol