Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023075-M09A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023075-M09A, RRID:AB_1581169
- Product name
- SWAP70 monoclonal antibody (M09A), clone 3H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SWAP70.
- Antigen sequence
QTQVELQARFSTELEREKLIRQQMEEQVAQKSSEL
EQYLQRVRELEDMYLKLQEALEDERQARQDEETVR
KLQA- Isotype
- IgG
- Antibody clone number
- 3H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SWAP-70 contributes to spontaneous transformation of mouse embryo fibroblasts.
Chang YT, Shu CL, Lai JY, Lin CY, Chuu CP, Morishita K, Ichikawa T, Jessberger R, Fukui Y
Experimental cell research 2015 Jun 20;
Experimental cell research 2015 Jun 20;
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in PC-12(Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in Raw 264.7.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in human spleen.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SWAP70 expression in transfected 293T cell line by SWAP70 monoclonal antibody (M09A), clone 3H8.Lane 1: SWAP70 transfected lysate(69 KDa).Lane 2: Non-transfected lysate.
