Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310791 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SWAP70 antibody: synthetic peptide directed towards the N terminal of human SWAP70
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNF
DKIEF NRMCWTLCVK- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Emissions from cooking microwave popcorn.
Expression and localization of SWAP-70 in human fetomaternal interface and placenta during tubal pregnancy and normal placentation.
Rosati JA, Krebs KA, Liu X
Critical reviews in food science and nutrition 2007;47(8):701-9
Critical reviews in food science and nutrition 2007;47(8):701-9
Expression and localization of SWAP-70 in human fetomaternal interface and placenta during tubal pregnancy and normal placentation.
Liu J, Li D, Cao B, Li YX, Herva R, Piao YS, Wang YL
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2007 Jul;55(7):701-8
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2007 Jul;55(7):701-8
No comments: Submit comment
No validations: Submit validation data