HPA006810

SWAP70 antibody from Atlas Antibodies
KIAA0640, SWAP-70
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006810
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006810, RRID:AB_1857683
Product name
Anti-SWAP70
Provider product page
Atlas Antibodies - HPA006810
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLEEAASRAAEEEKKRLQTQVELQARFSTELEREK
LIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQ
EALEDERQARQDEETVRKLQAR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -