HPA006810

SWAP70 antibody from Atlas Antibodies
KIAA0640, SWAP-70
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006810
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006810, RRID:AB_1236249
Product name
Anti-SWAP70
Provider product page
Atlas Antibodies - HPA006810
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLEEAASRAAEEEKKRLQTQVELQARFSTELEREK
LIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQ
EALEDERQARQDEETVRKLQAR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -