HPA006810

SWAP70 antibody from Sigma-Aldrich
KIAA0640, SWAP-70
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006810
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006810, RRID:AB_1857683
Product name
Anti-AC026250.16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006810
Antibody type
Polyclonal
Antigen
Switch-associated protein 70 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLEEAASRAAEEEKKRLQTQVELQARFSTELEREK
LIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQ
EALEDERQARQDEETVRKLQAR
Storage
-20C
Provider Type Product Number
- No reagents -