HPA021146

ATXN2 antibody from Atlas Antibodies

ATX2, SCA2, TNRC13

Western blot: Supportive data in Antibodypedia

Immunohistochemistry: Supportive data in Antibodypedia

Provider product page for HPA021146

Antibody data

Antibody Data
References [0]
Comments [0]
Validations
Western blot [1]
Immunohistochemistry [7]

Submit

Validation data

Product number: HPA021146
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021146, RRID:AB_1845132
Product name: Anti-ATXN2
Provider product page: Atlas Antibodies - HPA021146
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPV ARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSI GNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPAS PASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKP NET
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ATXN2 antibody HPA021146.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ATXN2 antibody HPA021146.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-ATXN2 antibody. Corresponding ATXN2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, skeletal muscle and testis using Anti-ATXN2 antibody HPA021146 (A) shows similar protein distribution across tissues to independent antibody HPA018295 (B).
Antibody #2 product nr: HPA018295, HPA020339
Antibody provider: Atlas Antibodies

: Show more