Antibody data
- Product number
- HPA021146
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021146, RRID:AB_1845132
- Product name
- Anti-ATXN2
- Provider product page
- Atlas Antibodies - HPA021146
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPV
ARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSI
GNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPAS
PASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKP
NET
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney using Anti-ATXN2 antibody HPA021146.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon using Anti-ATXN2 antibody HPA021146.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-ATXN2 antibody. Corresponding ATXN2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human colon, kidney, skeletal muscle and testis using Anti-ATXN2 antibody HPA021146 (A) shows similar protein distribution across tissues to independent antibody HPA018295 (B).
- Antibody #2 product nr
- HPA018295, HPA020339
- Antibody provider
- Atlas Antibodies
- Show more