Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010542-M12 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010542-M12, RRID:AB_10721490
- Product name
- HBXIP monoclonal antibody (M12), clone 4G1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant HBXIP.
- Antigen sequence
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRG
TLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESD
NGNIMIQKHDGITVAAHKMAS- Isotype
- IgG
- Antibody clone number
- 4G1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HBXIP expression in transfected 293T cell line by HBXIP monoclonal antibody (M12), clone 4G1.Lane 1: HBXIP transfected lysate(10.12 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HBXIP monoclonal antibody (M12), clone 4G1. Western Blot analysis of HBXIP expression in MCF-7.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HBXIP is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HBXIP on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol