H00010542-D02P

LAMTOR5 antibody from Abnova Corporation
HBXIP, MGC71071, XIP

Antibody data

Product number
H00010542-D02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010542-D02P, RRID:AB_10615903
Product name
HBXIP purified MaxPab rabbit polyclonal antibody (D02P)
Provider product page
Abnova Corporation - H00010542-D02P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human HBXIP protein.
Antigen sequence
MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKER
GRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAV
PLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLC
TDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSD
PTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.