HPA006812

LAMTOR5 antibody from Sigma-Aldrich
HBXIP, MGC71071, XIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006812
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006812, RRID:AB_1079040
Product name
Anti-HBXIP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006812
Antibody type
Polyclonal
Antigen
Hepatitis B virus X-interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEA
CGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKN
PSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQ
QAAKLTSDPTDIPVVCLESDNGNIMIQKHD
Storage
-20C
Provider Type Product Number
- No reagents -