H00057541-M10

ZNF398 antibody from Abnova Corporation
KIAA1339, P51, P71, ZER6

Antibody data

Product number
H00057541-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057541-M10, RRID:AB_1137553
Product name
ZNF398 monoclonal antibody (M10), clone 4G3
Provider product page
Abnova Corporation - H00057541-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF398.
Antigen sequence
MKGNYESLISMDYAINQPDVLSQIQPEGEHNTEDQ
AGPEESEIPTDPSEEPGISTSDILSWIKQEEEPQV
GAPPESKESDVYKSTYADEE
Isotype
IgG
Antibody clone number
4G3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -