Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183643 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 282 (ZNF282) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF282 antibody: synthetic peptide directed towards the C terminal of human ZNF282
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
FIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESL
KDHLR VHSGGPGPGA- Vial size
- 0.1 mg
Submitted references Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
Cheng J, Kapranov P, Drenkow J, Dike S, Brubaker S, Patel S, Long J, Stern D, Tammana H, Helt G, Sementchenko V, Piccolboni A, Bekiranov S, Bailey DK, Ganesh M, Ghosh S, Bell I, Gerhard DS, Gingeras TR
Science (New York, N.Y.) 2005 May 20;308(5725):1149-54
Science (New York, N.Y.) 2005 May 20;308(5725):1149-54
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Lanes: Lane 1:241 μg Bewo cells Lane 2: 041 μg HEK cells Lane 3: 041 μg JEG3 cells Lane 4: 041 μg PC3 cells Lane 5: 041 μg SHEP cells Primary Antibody Dilution: 1:0000Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:0500 Gene Name: ZNF282 Submitted by: Lisa Stubbs, University of Illinois