HPA024374

ZNF282 antibody from Sigma-Aldrich
HUB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024374
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024374, RRID:AB_1851322
Product name
Anti-ZNF282 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024374
Antibody type
Polyclonal
Antigen
Zinc finger protein 282 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLMS
LDAEGSVPKPDAPVQAEPREEPCVWEQRHPEEREI
PMDPEAGAEPLVPAQDASSQVKREDTLCVRGQRGL
EERAIPTESITDSPISAQDLLSRIKQEEHQCVWDQ
QDLA
Storage
-20C
Provider Type Product Number
- No reagents -