HPA006714

RTF1 antibody from Sigma-Aldrich
KIAA0252
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006714
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006714, RRID:AB_1079855
Product name
Anti-RTF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006714
Antibody type
Polyclonal
Antigen
RNA polymerase-associated protein RTF1 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGL
QLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFS
AGMQLPTLDEINKKELSIKEALNYKFNDQDIEEIV
KEKERFRKAPPNYAMKKTQL
Storage
-20C
Provider Type Product Number
- No reagents -