Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109567 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 212 (ZNF212) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF212 antibody: synthetic peptide directed towards the N terminal of human ZNF212
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
RSLENDGVCFTEQEWENLEDWQKELYRNVMESNYE
TLVSLKVLGQTEGEA- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Human chromosome 7: DNA sequence and biology.
Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Döhner H, Döhner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC
Science (New York, N.Y.) 2003 May 2;300(5620):767-72
Science (New York, N.Y.) 2003 May 2;300(5620):767-72
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-ZNF212 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate; ZNF212 antibody - N-terminal region (AP42224PU-N) in Human Jurkat cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Lung; Rabbit Anti-ZNF212 antibody. . Paraffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; ZNF212 antibody - N-terminal region (AP42224PU-N) in Human Lung using Immunohistochemistry
