HPA021439

C9orf116 antibody from Atlas Antibodies
MGC29761, PIERCE1, RbEST47
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021439
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021439, RRID:AB_1845799
Product name
Anti-C9orf116
Provider product page
Atlas Antibodies - HPA021439
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVY
LEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -