Antibody data

Product number
H00009158-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009158-M01, RRID:AB_1574879
Product name
FIBP monoclonal antibody (M01), clone 1E5
Provider product page
Abnova Corporation - H00009158-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FIBP.
Antigen sequence
MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVAL
RVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLL
HAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVR
EVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDN
FKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAA
IVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNW
TLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKD
LLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLV
NVAAKLTHNKDVGDLFVDLVEKFVEPCRSDHWPLS
DVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGC
LLRLYHD
Isotype
IgG
Antibody clone number
1E5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -