Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA27S - Provider product page

- Provider
- ReliaTech GmbH
- Product name
- CCM-3
- Antibody type
- Polyclonal
- Antigen
- Recombinant human CCM3
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MGSSHHHHHHSSGLVPRGSMRMTMEEMKNEAETTS
MVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKA
EKENPGLTQDIIMKILEKKSVEVNFTESLLRMAAD
DVEEYMIERPEPEFQDLNEKARALKQILSKIPDEI
NDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQN
RRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVF
VSANRLIHQTNLILQTFKTVA- Antibody clone number
- Rabbit IG
- Vial size
- 100 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- K.O. = knock out (completely deleted) K.D. = knock down (not completely deleted) OV. = over expressed in COS1 cells Western Analysis of anti-human CCM-3. The experiment was performed by Elisabetta Dejana’s group, IFOM-IEO-Campus, Milan Italy
- Sample type
- Cell lysate
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Immunofluorescence staining (green) of human foreskin (cryo-section of unfixed tissue) with anti-human CCM3 (K5548; dilution 1:50) [Cat# 102-PA27]. A) Note specific staining in the epidermis and in the wall of microvessels. B) Negative control of a consecutive section. Nuclei counter-stained with Dapi (blue). Specimen provided by Prof. Dr. J. Wilting, Goettingen. The experiment was performed by the research group of Prof. Dr. J. Wilting, University Göttingen, Germany.
- Sample type
- Human Foreskin