HPA003402

KHNYN antibody from Sigma-Aldrich
KIAA0323
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003402
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003402, RRID:AB_1079190
Product name
Anti-KIAA0323 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003402
Antibody type
Polyclonal
Antigen
KIAA0323 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFTFVGNLFMVPDDPLGRNGPTLDEFLKKPARTQG
SSKAQHPSRGFAEHGKQQQGREEEKGSGGIRKTRE
TERLRRQLLEVFWGQDHKVDFILQREPYCRDINQ
Storage
-20C
Provider Type Product Number
- No reagents -